PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A10G1002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 243aa    MW: 27955.4 Da    PI: 6.1034
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A10G1002genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
      Gh_A10G1002 14 KGPWTHEEDQILISYIQKHGHQNWRALPKQAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding52.61.1e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l
      Gh_A10G1002  67 RGNFSLEEEETIIQLHELLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.109961IPR017930Myb domain
SuperFamilySSF466897.52E-3110108IPR009057Homeodomain-like
SMARTSM007179.5E-141363IPR001005SANT/Myb domain
PfamPF002492.2E-161461IPR001005SANT/Myb domain
CDDcd001672.16E-101661No hitNo description
PROSITE profilePS5129425.16562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2665117IPR009057Homeodomain-like
SMARTSM007171.3E-1466114IPR001005SANT/Myb domain
PfamPF002492.7E-1567112IPR001005SANT/Myb domain
CDDcd001672.74E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MVRAPCCDKM GLKKGPWTHE EDQILISYIQ KHGHQNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF SLEEEETIIQ LHELLGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRLKQYQ  120
TKPDNSKKKL KSKNKIKSEP SITSHSESDE VPSSSGEVVS SIIDGSDHRE DNNMDSWECL  180
VEIDESFWSD ALSSDEPQVP SLSTDNIMEP NYTFGENLDD SMEFWYDLFI KAGGSEQGFI  240
TQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKRLKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0407830.0KM040783.2 Gossypium hirsutum cultivar Lumianyan 32 MYB12 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012452969.11e-167PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH41e-79MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A0D2T9G11e-167A0A0D2T9G1_G
STRINGGLYMA20G35180.16e-92(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.12e-77myb domain protein 14